OPRL1 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098539
Artikelname: OPRL1 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098539
Hersteller Artikelnummer: orb2098539
Alternativnummer: BYT-ORB2098539-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OPRL1
Konjugation: FITC
Alternative Synonym: NOP, OOR, KOR3, NOPr, OPRL, ORL1, KOR-3, NOCIR
OPRL1 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 872588
UniProt: P79292
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ