NPFFR2 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098542
Artikelname: NPFFR2 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098542
Hersteller Artikelnummer: orb2098542
Alternativnummer: BYT-ORB2098542-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NPFFR2
Konjugation: FITC
Alternative Synonym: GPR74, NPFF2, NPGPR, HLWAR77
NPFFR2 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 444264
UniProt: A0PJM9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYA