NPFFR2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098544
Artikelname: NPFFR2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098544
Hersteller Artikelnummer: orb2098544
Alternativnummer: BYT-ORB2098544-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NPFFR2
Konjugation: HRP
Alternative Synonym: GPR74, NPFF2, NPGPR, HLWAR77
NPFFR2 Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 444264
UniProt: A0PJM9
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT