SSR5 Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098547
Artikelname: SSR5 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098547
Hersteller Artikelnummer: orb2098547
Alternativnummer: BYT-ORB2098547-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSR5
Konjugation: HRP
Alternative Synonym: SS-5-R
SSR5 Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 40 kDa
NCBI: 001044
UniProt: P35346
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGC