SSR5 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098549
| Artikelname: |
SSR5 Antibody - middle region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2098549 |
| Hersteller Artikelnummer: |
orb2098549 |
| Alternativnummer: |
BYT-ORB2098549-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SSR5 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
SS-5-R |
| SSR5 Antibody - middle region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
40 kDa |
| NCBI: |
001044 |
| UniProt: |
P35346 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGC |
