SSR5 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098549
Artikelname: |
SSR5 Antibody - middle region : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2098549 |
Hersteller Artikelnummer: |
orb2098549 |
Alternativnummer: |
BYT-ORB2098549-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SSR5 |
Konjugation: |
Biotin |
Alternative Synonym: |
SS-5-R |
SSR5 Antibody - middle region : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
40 kDa |
NCBI: |
001044 |
UniProt: |
P35346 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGC |