SSTR2 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098552
Artikelname: |
SSTR2 Antibody - middle region : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2098552 |
Hersteller Artikelnummer: |
orb2098552 |
Alternativnummer: |
BYT-ORB2098552-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SSTR2 |
Konjugation: |
Biotin |
SSTR2 Antibody - middle region : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
41kDa |
NCBI: |
001041 |
UniProt: |
P30874 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPAL |