SSTR1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098557
Artikelname: SSTR1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098557
Hersteller Artikelnummer: orb2098557
Alternativnummer: BYT-ORB2098557-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SSTR1
Konjugation: FITC
Alternative Synonym: SS1R, SS1-R, SRIF-2, SS-1-R
SSTR1 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 001040
UniProt: P28646
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD