TAC1 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098572
| Artikelname: |
TAC1 Antibody - middle region : FITC, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2098572 |
| Hersteller Artikelnummer: |
orb2098572 |
| Alternativnummer: |
BYT-ORB2098572-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human TAC1 |
| Konjugation: |
FITC |
| Alternative Synonym: |
NK2, NPK, NKNA, TAC2, Hs.2563 |
| TAC1 Antibody - middle region : FITC |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
13kDa |
| NCBI: |
054703 |
| UniProt: |
P20366 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH |
