TAC1 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098572
Artikelname: |
TAC1 Antibody - middle region : FITC, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2098572 |
Hersteller Artikelnummer: |
orb2098572 |
Alternativnummer: |
BYT-ORB2098572-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human TAC1 |
Konjugation: |
FITC |
Alternative Synonym: |
NK2, NPK, NKNA, TAC2, Hs.2563 |
TAC1 Antibody - middle region : FITC |
Klonalität: |
Polyclonal |
Molekulargewicht: |
13kDa |
NCBI: |
054703 |
UniProt: |
P20366 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH |