CORT Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098579
| Artikelname: |
CORT Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2098579 |
| Hersteller Artikelnummer: |
orb2098579 |
| Alternativnummer: |
BYT-ORB2098579-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human CORT |
| Konjugation: |
Biotin |
| Alternative Synonym: |
SST2, CST-14, CST-17, CST-29 |
| CORT Antibody - N-terminal region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
2kDa |
| NCBI: |
001293 |
| UniProt: |
O00230 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFL |
