AVPR2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098580
Artikelname: AVPR2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098580
Hersteller Artikelnummer: orb2098580
Alternativnummer: BYT-ORB2098580-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AVPR2
Konjugation: HRP
Alternative Synonym: DI1, DIR, NDI, V2R, ADHR, DIR3
AVPR2 Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 000045
UniProt: P30518
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: NPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTS