Vamp8 Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098583
Artikelname: Vamp8 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098583
Hersteller Artikelnummer: orb2098583
Alternativnummer: BYT-ORB2098583-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Vamp8
Konjugation: HRP
Vamp8 Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 11kDa
NCBI: 114015
UniProt: Q9WUF4
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILIL