Vamp8 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098584
Artikelname: Vamp8 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098584
Hersteller Artikelnummer: orb2098584
Alternativnummer: BYT-ORB2098584-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Vamp8
Konjugation: FITC
Vamp8 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 11kDa
NCBI: 114015
UniProt: Q9WUF4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILIL