STX4 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098590
| Artikelname: |
STX4 Antibody - middle region : FITC, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2098590 |
| Hersteller Artikelnummer: |
orb2098590 |
| Alternativnummer: |
BYT-ORB2098590-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human STX4 |
| Konjugation: |
FITC |
| Alternative Synonym: |
STX4A, p35-2 |
| STX4 Antibody - middle region : FITC |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
34kDa |
| NCBI: |
004595 |
| UniProt: |
Q12846 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE |
