Snap29 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098609
Artikelname: |
Snap29 Antibody - middle region : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2098609 |
Hersteller Artikelnummer: |
orb2098609 |
Alternativnummer: |
BYT-ORB2098609-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Rat Snap29 |
Konjugation: |
Biotin |
Alternative Synonym: |
Gs32 |
Snap29 Antibody - middle region : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
28kDa |
NCBI: |
446262 |
UniProt: |
Q9JI56 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK |