Nckipsd Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098625
Artikelname: Nckipsd Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098625
Hersteller Artikelnummer: orb2098625
Alternativnummer: BYT-ORB2098625-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Nckipsd
Konjugation: HRP
Nckipsd Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 001100327
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEDVIRCYLEELLH