Nckipsd Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098627
Artikelname: |
Nckipsd Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2098627 |
Hersteller Artikelnummer: |
orb2098627 |
Alternativnummer: |
BYT-ORB2098627-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Nckipsd |
Konjugation: |
Biotin |
Nckipsd Antibody - C-terminal region : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
56kDa |
NCBI: |
001100327 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: LPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEDVIRCYLEELLH |