NCKIPSD Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098628
Artikelname: NCKIPSD Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098628
Hersteller Artikelnummer: orb2098628
Alternativnummer: BYT-ORB2098628-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NCKIPSD
Konjugation: HRP
Alternative Synonym: DIP, DIP1, ORF1, WISH, VIP54, AF3P21, SPIN90, WASLBP
NCKIPSD Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 909119
UniProt: Q9NZQ3
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLG