NCKIPSD Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098629
Artikelname: NCKIPSD Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098629
Hersteller Artikelnummer: orb2098629
Alternativnummer: BYT-ORB2098629-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NCKIPSD
Konjugation: FITC
Alternative Synonym: DIP, DIP1, ORF1, WISH, VIP54, AF3P21, SPIN90, WASLBP
NCKIPSD Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 909119
UniProt: Q9NZQ3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLG