DOC2B Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098632
Artikelname: DOC2B Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098632
Hersteller Artikelnummer: orb2098632
Alternativnummer: BYT-ORB2098632-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human DOC2B
Konjugation: FITC
Alternative Synonym: DOC2BL
DOC2B Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 003576
UniProt: Q14184
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNE