CADPS2 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098634
Artikelname: CADPS2 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098634
Hersteller Artikelnummer: orb2098634
Alternativnummer: BYT-ORB2098634-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human CADPS2
Konjugation: HRP
Alternative Synonym: CAPS2
CADPS2 Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 001009571
UniProt: Q86UW7
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: RFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRA