CADPS2 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098636
Artikelname: CADPS2 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098636
Hersteller Artikelnummer: orb2098636
Alternativnummer: BYT-ORB2098636-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human CADPS2
Konjugation: Biotin
Alternative Synonym: CAPS2
CADPS2 Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 001009571
UniProt: Q86UW7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRA