CADPS Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098637
Artikelname: CADPS Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098637
Hersteller Artikelnummer: orb2098637
Alternativnummer: BYT-ORB2098637-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAPS1
Konjugation: HRP
Alternative Synonym: CAPS, CAPS1, CADPS1, UNC-31
CADPS Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 50kDa
UniProt: Q9ULU8
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: EVVIMEVQGLKSLAPNRIVYCTMEVEGGEKLQTDQAEASKPTVIRRNRRE