CADPS Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098639
Artikelname: CADPS Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098639
Hersteller Artikelnummer: orb2098639
Alternativnummer: BYT-ORB2098639-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAPS1
Konjugation: Biotin
Alternative Synonym: CAPS, CAPS1, CADPS1, UNC-31
CADPS Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 50kDa
UniProt: Q9ULU8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EVVIMEVQGLKSLAPNRIVYCTMEVEGGEKLQTDQAEASKPTVIRRNRRE