Rph3a Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098642
| Artikelname: |
Rph3a Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2098642 |
| Hersteller Artikelnummer: |
orb2098642 |
| Alternativnummer: |
BYT-ORB2098642-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Biotin |
| Alternative Synonym: |
AU022689, AW108370, 2900002P20Rik |
| Rph3a Antibody - N-terminal region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
75kDa |
| NCBI: |
035416 |
| UniProt: |
P47708 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR |
