ERC1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098651
Artikelname: ERC1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098651
Hersteller Artikelnummer: orb2098651
Alternativnummer: BYT-ORB2098651-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ERC1
Konjugation: Biotin
Alternative Synonym: ELKS, Cast2, ERC-1, RAB6IP2
ERC1 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 128kDa
NCBI: 829884
UniProt: Q8IUD2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KLMADNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHL