SYT12 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098654
| Artikelname: |
SYT12 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2098654 |
| Hersteller Artikelnummer: |
orb2098654 |
| Alternativnummer: |
BYT-ORB2098654-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SYT12 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
SYT11, sytXII |
| SYT12 Antibody - N-terminal region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
46 kDa |
| NCBI: |
001171351 |
| UniProt: |
Q8IV01 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LLGIAAVSLWKLWTSGSFPSPSPFPNYDYRYLQQKYGESCAEAREKRVPA |
