SYT12 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098654
Artikelname: SYT12 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098654
Hersteller Artikelnummer: orb2098654
Alternativnummer: BYT-ORB2098654-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYT12
Konjugation: Biotin
Alternative Synonym: SYT11, sytXII
SYT12 Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 46 kDa
NCBI: 001171351
UniProt: Q8IV01
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LLGIAAVSLWKLWTSGSFPSPSPFPNYDYRYLQQKYGESCAEAREKRVPA