SYT5 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098668
Artikelname: SYT5 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098668
Hersteller Artikelnummer: orb2098668
Alternativnummer: BYT-ORB2098668-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SYT5
Konjugation: FITC
SYT5 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 003171
UniProt: O00445
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDR