SYT2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098670
Artikelname: SYT2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098670
Hersteller Artikelnummer: orb2098670
Alternativnummer: BYT-ORB2098670-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SYT2
Konjugation: HRP
Alternative Synonym: CMS7, MYSPC, SytII
SYT2 Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 796376
UniProt: Q8N9I0
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: AIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK