SYT2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098672
Artikelname: SYT2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098672
Hersteller Artikelnummer: orb2098672
Alternativnummer: BYT-ORB2098672-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SYT2
Konjugation: Biotin
Alternative Synonym: CMS7, MYSPC, SytII
SYT2 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 796376
UniProt: Q8N9I0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK