SYT16 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098674
Artikelname: SYT16 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098674
Hersteller Artikelnummer: orb2098674
Alternativnummer: BYT-ORB2098674-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYT16
Konjugation: FITC
Alternative Synonym: SYT14L, syt14r, Strep14, CHR14SYT
SYT16 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 72kDa
NCBI: 114120
UniProt: Q17RD7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DKLDQDLDNIQIQETYFEDEEQDNDWSQEDANSLFLEVDHFSCCNSDLQD