SYT11 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098678
Artikelname: SYT11 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098678
Hersteller Artikelnummer: orb2098678
Alternativnummer: BYT-ORB2098678-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYT11
Konjugation: Biotin
Alternative Synonym: SYT12, sytXI
SYT11 Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 689493
UniProt: Q9BT88
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAE