Synpr Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098684
Artikelname: Synpr Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098684
Hersteller Artikelnummer: orb2098684
Alternativnummer: BYT-ORB2098684-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: Biotin
Alternative Synonym: SPO, 1500003F20Rik
Synpr Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 082328
UniProt: Q8BGN8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV