SCAMP1 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098699
Artikelname: SCAMP1 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098699
Hersteller Artikelnummer: orb2098699
Alternativnummer: BYT-ORB2098699-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCAMP1
Konjugation: Biotin
Alternative Synonym: SCAMP, SCAMP37
SCAMP1 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 004857
UniProt: P56603
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVK