TMPRSS2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2116601
Artikelname: TMPRSS2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2116601
Hersteller Artikelnummer: orb2116601
Alternativnummer: BYT-ORB2116601-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMPS2
Konjugation: HRP
Alternative Synonym: PRSS10
TMPRSS2 Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 005647
UniProt: O15393
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: GAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMM