ADAT1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125007
Artikelname: ADAT1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125007
Hersteller Artikelnummer: orb2125007
Alternativnummer: BYT-ORB2125007-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ADAT1
Konjugation: HRP
Alternative Synonym: HADAT1
ADAT1 Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 95626
UniProt: Q9NVB7
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF