NONO Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125010
Artikelname: NONO Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125010
Hersteller Artikelnummer: orb2125010
Alternativnummer: BYT-ORB2125010-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NONO
Konjugation: HRP
Alternative Synonym: P54, NMT55, NRB54, MRXS34, P54NRB, PPP1R114
NONO Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 031389
UniProt: Q15233
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY