NONO Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2125012
| Artikelname: |
NONO Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2125012 |
| Hersteller Artikelnummer: |
orb2125012 |
| Alternativnummer: |
BYT-ORB2125012-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IF, IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human NONO |
| Konjugation: |
Biotin |
| Alternative Synonym: |
P54, NMT55, NRB54, MRXS34, P54NRB, PPP1R114 |
| NONO Antibody - C-terminal region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
52kDa |
| NCBI: |
031389 |
| UniProt: |
Q15233 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
