XPOT Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125016
Artikelname: XPOT Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125016
Hersteller Artikelnummer: orb2125016
Alternativnummer: BYT-ORB2125016-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XPOT
Konjugation: HRP
Alternative Synonym: XPO3
XPOT Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 110kDa
NCBI: 009166
UniProt: O43592
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL