IRAK3 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125020
Artikelname: IRAK3 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125020
Hersteller Artikelnummer: orb2125020
Alternativnummer: BYT-ORB2125020-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IRAK3
Konjugation: FITC
Alternative Synonym: ASRT5, IRAKM
IRAK3 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 009130
UniProt: Q9Y616
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL