KRR1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125030
Artikelname: KRR1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125030
Hersteller Artikelnummer: orb2125030
Alternativnummer: BYT-ORB2125030-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KRR1
Konjugation: Biotin
Alternative Synonym: HRB2, RIP-1
KRR1 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 008974
UniProt: Q13601
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET