HNRPUL1 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125035
Artikelname: HNRPUL1 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125035
Hersteller Artikelnummer: orb2125035
Alternativnummer: BYT-ORB2125035-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HNRPUL1
Konjugation: FITC
Alternative Synonym: E1BAP5, E1B-AP5, HNRPUL1
HNRPUL1 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 653333
UniProt: Q9BUJ2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG