U1SNRNPBP Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125037
Artikelname: U1SNRNPBP Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125037
Hersteller Artikelnummer: orb2125037
Alternativnummer: BYT-ORB2125037-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human U1SNRNPBP
Konjugation: HRP
Alternative Synonym: HM-1, U1SNRNPBP
U1SNRNPBP Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 851034
UniProt: Q5XKN9
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR