U1SNRNPBP Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125039
Artikelname: U1SNRNPBP Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125039
Hersteller Artikelnummer: orb2125039
Alternativnummer: BYT-ORB2125039-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human U1SNRNPBP
Konjugation: Biotin
Alternative Synonym: HM-1, U1SNRNPBP
U1SNRNPBP Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 851034
UniProt: Q5XKN9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR