NUDT21 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125043
Artikelname: NUDT21 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125043
Hersteller Artikelnummer: orb2125043
Alternativnummer: BYT-ORB2125043-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NUDT21
Konjugation: HRP
Alternative Synonym: CPSF5, CFIM25
NUDT21 Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 008937
UniProt: O43809
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV