SFRS1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125056
Artikelname: SFRS1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125056
Hersteller Artikelnummer: orb2125056
Alternativnummer: BYT-ORB2125056-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SFRS1
Konjugation: FITC
Alternative Synonym: ASF, SF2, SFRS1, SF2p33, SRp30a
SFRS1 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 008855
UniProt: Q07955
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR