LGTN Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2125058
| Artikelname: |
LGTN Antibody - middle region : HRP, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2125058 |
| Hersteller Artikelnummer: |
orb2125058 |
| Alternativnummer: |
BYT-ORB2125058-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human LGTN |
| Konjugation: |
HRP |
| Alternative Synonym: |
LGTN, HCA56 |
| LGTN Antibody - middle region : HRP |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
65kDa |
| NCBI: |
008824 |
| UniProt: |
P41214 |
| Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequenz: |
Synthetic peptide located within the following region: KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ |
