LGTN Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125059
Artikelname: LGTN Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125059
Hersteller Artikelnummer: orb2125059
Alternativnummer: BYT-ORB2125059-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LGTN
Konjugation: FITC
Alternative Synonym: LGTN, HCA56
LGTN Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 008824
UniProt: P41214
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ