HNRPA0 Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125061
Artikelname: HNRPA0 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125061
Hersteller Artikelnummer: orb2125061
Alternativnummer: BYT-ORB2125061-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HNRPA0
Konjugation: HRP
Alternative Synonym: HNRPA0
HNRPA0 Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 006796
UniProt: Q13151
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG