HNRPA0 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125062
Artikelname: HNRPA0 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125062
Hersteller Artikelnummer: orb2125062
Alternativnummer: BYT-ORB2125062-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HNRPA0
Konjugation: FITC
Alternative Synonym: HNRPA0
HNRPA0 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 006796
UniProt: Q13151
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG