CPSF4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125080
Artikelname: CPSF4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125080
Hersteller Artikelnummer: orb2125080
Alternativnummer: BYT-ORB2125080-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CPSF4
Konjugation: FITC
Alternative Synonym: NAR, NEB1, NEB-1, CPSF30
CPSF4 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 76662
UniProt: O95639
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK