CPSF4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2125080
Artikelname: |
CPSF4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2125080 |
Hersteller Artikelnummer: |
orb2125080 |
Alternativnummer: |
BYT-ORB2125080-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human CPSF4 |
Konjugation: |
FITC |
Alternative Synonym: |
NAR, NEB1, NEB-1, CPSF30 |
CPSF4 Antibody - C-terminal region : FITC |
Klonalität: |
Polyclonal |
Molekulargewicht: |
24kDa |
NCBI: |
76662 |
UniProt: |
O95639 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK |